Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Neuronal acetylcholine receptor subunit beta-4 (CHRNB4)

This Recombinant Chicken Neuronal acetylcholine receptor subunit beta-4 (CHRNB4) spans the amino acid sequence from region 4-470.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit beta-4, Neuronal acetylcholine receptor non-alpha-3 chain, N-alpha 3

UniProt

P26153

Expression Region

4-470

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ADAEEKLMNHLLSPDRYNKLIRPAVNSSQLVSIELQVSLAQLISVNEREQIMTTNVWLNQ EWIDYRLAWKPSDYEGINMLRIPAKHIWLPDIVLYNNADGTYEVSLYTNAIVQNNGSIRW LPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKTSMASMDDFTPSGEWDI VALPGRRTENPLDPNYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRS PSTHTMPPWVKLVFLERLPAYLFMKRPENNSPRQKPANCKKTRAENLCMDPADFYKNSTY FVNTASAKKYDMKITDTLDNVSSHQDFRLRTGTKFSPEVQEAIDGVSFIAEHMKSDDNDQ SVIEDWKYVAMVVDRLFLWIFVLVCVLGTVGLFLQPLFQNHIAATNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL
BNC940780-500 1x 500 µL

HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF594 conjugate, 0.1mg/mL
BNC942560-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/813), CF740 conjugate, 0.1mg/mL
BNC740813-100 1x 100 µL

CD74 (CLIP/813), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details