Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Acetylcholine receptor subunit epsilon (CHRNE)

This Recombinant Bovine Acetylcholine receptor subunit epsilon (CHRNE) spans the amino acid sequence from region 21-491.

Product Specifications

Product Name Alternative

Acetylcholine receptor subunit epsilon

UniProt

P02715

Expression Region

21-491

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KNEELRLYHYLFDTYDPGRRPVQEPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW QDYRLNYSKGDFGGVETLRVPSELVWLPEIVLENNIDGQFGVAYEANVLVSEGGYLSWLP PAIYRSTCAVEVTYFPFDWQNCSLVFRSQTYNAEEVEFVFAVDDEGKTISKIDIDTEAYT ENGEWAIDFCPGVIRRHDGDSAGGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKTPETSLSVPLLGRYLIFVMVVATLIVM NCVIVLNVSLRTPTTHAMSPRLRYVLLELLPQLLGSGAPPEIPRAASPPRRASSLGLLLR AEELILKKPRSELVFEQQRHRHGTWTATLCQNLGAAAPEIRCCVDAVNFVASSTRDQEAT GEEVSDWVRMGKALDSICFWAALVLFLVGSSLIFLGAYFNRVPQLPYPPCM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF555 conjugate, 0.1mg/mL
BNC550393-500 1x 500 µL

Cytokeratin, multi (C11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details