Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Neuronal acetylcholine receptor subunit beta-2 (CHRNB2)

This Recombinant Chicken Neuronal acetylcholine receptor subunit beta-2 (CHRNB2) spans the amino acid sequence from region 19-491.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit beta-2, Neuronal acetylcholine receptor non-alpha-1 chain, N-alpha 1

UniProt

P09484

Expression Region

19-491

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TDTEERLVEYLLDPTRYNKLIRPATNGSQLVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVISYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI VALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMPPWVRTLFLRKLPALLFMKQPQQNCARQRLRQRRQTQERAAAATLFLRAGARAC ACYANPGAAKAEGLNGYRERQGQGPDPPAPCGCGLEEAVEGVRFIADHMRSEDDDQSVSE DWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYATNSLLQLGQGTPTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM162B (NM_001085480) Human Over-expression Lysate
LC421323 20 µg

FAM162B (NM_001085480) Human Over-expression Lysate

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL
BNC042602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgA Immunoglobulin (IA761), CF405S conjugate, 0.1mg/mL
BNC040761-100 1x 100 µL

Human IgA Immunoglobulin (IA761), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701769 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS631464 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
Tau Recombinant Rabbit monoclonal Antibody
HA723850 100 µL

Tau Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details