Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis outer membrane protein C (tcpC)

This Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis outer membrane protein C (tcpC) spans the amino acid sequence from region 17-489.

Product Specifications

Product Name Alternative

Toxin coregulated pilus biosynthesis outer membrane protein C, TCP pilus biosynthesis protein tcpC

UniProt

P29481

Expression Region

17-489

Origin

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNTNLLKDNLASEQSVINLSKSSNEAKSRNIEFLSGAYLSERKVPKHDIKFSGKYVEFE SKSPIELIDVLDGLSKQYNIQYVFSDELEDENSEENKKSSGSSSAKKIKYSGPLAGFFDY LSSAYNMHFEFGHNNLVKAYHYKNQVFNLQQYFDDNKFSSSMQIGGTSGTSSGLKGTADT AIESNSWEKIDEFLSASLGETGKFTIFEDYSLVTVKARPDKFLLLHTFFDKLINESKMQI AVDYRVVSLSEERLNQLAAKFGIENAGKYSITSDMVDAISLSQVGGGLGASYRSASARLD AVVNELSQEVMHEGHFIGIPNRVMPLNVTTNSKYISSIETTKDTNTDEETRTVKVSDLVT GFSMMVMPKILDDGRIQISSGFSRKQLVSIGTAQGITLPTVDENESMNTVTMNPGEVRLA MLFKDNYIQNSNGVQLLGGGTENKKSARYIAVLVGASSYKTNDLASNRVNIYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF4 Protein Vector (Human) (pPM-N-D-C-HA)
PV323528 500 ng

ARHGEF4 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
N-Methyl Morpholine 98% Extrapure
173402500 2.5 L

N-Methyl Morpholine 98% Extrapure

Sign In for Pricing
View Details
ERp72 (PDIA4) Mouse Monoclonal Antibody [Clone ID: OTI2B11]
TA503885 100 µL

ERp72 (PDIA4) Mouse Monoclonal Antibody [Clone ID: OTI2B11]

Sign In for Pricing
View Details
FAM3D Rabbit Polyclonal Antibody (APC-Cy7)
orb2510974 100 µL

FAM3D Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PDGFD Polyclonal Antibody
orb616318-01 50 μL

PDGFD Polyclonal Antibody

Sign In for Pricing
View Details
PDGFD Polyclonal Antibody
orb616318-02 100 µL

PDGFD Polyclonal Antibody

Sign In for Pricing
View Details