Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal acetylcholine receptor subunit beta-4 (Chrnb4)

This Recombinant Mouse Neuronal acetylcholine receptor subunit beta-4 (Chrnb4) spans the amino acid sequence from region 21-495.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit beta-4

UniProt

Q8R493

Expression Region

21-495

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWL KQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSI QWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEW DIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCG EKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHH RSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPHSSQLHLTTAEATSTSALGPS SPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSSGRFRQDLQEALEGVSFIAQH LESDDRDQSVIEDWKFVAMVVDRLFLWVFVIVCILGTMGLFLPPLFQIHAPSKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: B-B10]
AM31169BT-N 1 mL (100 Tests)

IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: B-B10]

Sign In for Pricing
View Details
Mouse Car5a activation kit by CRISPRa
GA200527 1 Kit

Mouse Car5a activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), Biotin conjugate, 0.1mg/mL
BNCB3131-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216D-01 50 Tests

PE Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PE Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216D-02 100 Tests

PE Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details