Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal acetylcholine receptor subunit beta-2 (Chrnb2)

This Recombinant Mouse Neuronal acetylcholine receptor subunit beta-2 (Chrnb2) spans the amino acid sequence from region 26-501.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit beta-2

UniProt

Q9ERK7

Expression Region

26-501

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDI IALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGTLFFRKGPAAD PCTCFVNPASMQGLAGAFQAEPAAAGLGRSMGPCSCGLREAVDGVRFIADHMRSEDDDQS VREDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTATTFLHSDHSAPSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SRR Antibody
RC-5915-01 50 μL

Recombinant SRR Antibody

Sign In for Pricing
View Details
Recombinant SRR Antibody
RC-5915-02 100 µL

Recombinant SRR Antibody

Sign In for Pricing
View Details
Recombinant SRR Antibody
RC-5915-03 1 mL

Recombinant SRR Antibody

Sign In for Pricing
View Details
FAM123C (AMER3) Human Gene Knockout Kit (CRISPR)
KN423275 1 Kit

FAM123C (AMER3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ), -Succinyl WGA-, 1mL 30nm
GP-2102-30 1 mL

Colloidal Gold Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ), -Succinyl WGA-, 1mL 30nm

Sign In for Pricing
View Details
EIF3B Rabbit Polyclonal Antibody
TA362504 100 µL

EIF3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details