Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Cytochrome b-245 heavy chain (CYBB)

This Recombinant Pig Cytochrome b-245 heavy chain (CYBB) spans the amino acid sequence from region 1-484.

Product Specifications

Product Name Alternative

Cytochrome b-245 heavy chain, EC= 1.-.-.-, CGD91-phox, Cytochrome b (558) subunit beta, Cytochrome b558 subunit beta, Heme-binding membrane glycoprotein gp91phox, Neutrophil cyt

UniProt

P52649

Expression Region

1-484

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

STRVRRQLDRNLTFHKMVAWMIALHATIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGD KPNETYLNFVRQRIKNPEGGLYVAVTRLAGITGVVITLCLILIITSSTKTIRRSYFEVFW YTHHLFVIFFIGLAIHGAERIVRRQTPKSLLVHDPKACAQNISQWGKIKDCPIPEFAGNP PMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFRMEVGQYIF VKRPAVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIA VDGPFGTASEDVFSYQVVMLVGAGIGVTPFASILKSVWYKYCNNATNLRLKKIYFYWLCR DTHAFEWFADLLQLLETQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLK QKTLYGRPNWDNEFKTIASQHPTTRIGVFLCGPEALAETLNKQCISNSDSSPRGVHFIFN KENF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details