Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yclI (yclI)

This Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yclI (yclI) spans the amino acid sequence from region 1-486.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease yclI

UniProt

P94412

Expression Region

1-486

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFIKRAFWNMKAKKGKTLLQLFVFTVICVFVLSGLAIQSAAQKSSELARQELGGSVTLQ VDRQKQMEKQQDSGEKRSFESTPIKVSDANKLAALDHVKSYNYTTSASANAGNFDAIESS SSSDSSSSSSSSNAKNSQGGGQGGPQMVQADLSIEGVISTALVDDFSDGDSKITDGRAIT KSDVGKKVTVINETLAEENDLSVGDSITIESATDEDTTVKLKIVGIYKTTSSGDDQAQNF SFLNPYNKLYTPYTATAALKGDDYKNTIDSAVYYMDDAKNMDTFVKAAKKTSIDFDTYTL NTNDQLYQQMVGPIENVASFSKNVVYLVSVAGAVILGLIVMMSIRERKYEMGVLMAIGEK RWKLIGQFLTEILIVAVIAIGLASVTGNLVANQLGNQLLSQQISSSTDSTQTASGQMPGG GGGMGGKMFGHSSSNVDVIDSLNVAVSMNDMLILGGIGILIAIIATLLPSISVLRLHPKT ILTKQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kir6.2 K+ channel Mouse Monoclonal Antibody
orb2957983-01 50 µg

Kir6.2 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Kir6.2 K+ channel Mouse Monoclonal Antibody
orb2957983-02 100 µg

Kir6.2 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Kir6.2 K+ channel Mouse Monoclonal Antibody
orb2957983-03 1 mg

Kir6.2 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (AP)
MBS6370749-01 0.1 mL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (AP)

Sign In for Pricing
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (AP)
MBS6370749-02 5x 0.1 mL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (AP)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C14orf28 (C14orf28)
MBS1388410-01 0.02 mg (E-Coli)

Recombinant Human Uncharacterized protein C14orf28 (C14orf28)

Sign In for Pricing
View Details