Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0912 (Mb0912)

This Recombinant Uncharacterized protein Mb0912 (Mb0912) spans the amino acid sequence from region 1-490.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0912

UniProt

P64744

Expression Region

1-490

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYAKRIGQVGALAVVLGVGAAVTTHAIGSAAPTDPSSSSTDSPVDACSPLGGSASSLAA IPGASVPQVGVRQVDPGSIPDDLLNALIDFLAAVRNGLVPIIENRTPVANPQQVSVPEGG TVGPVRFDACDPDGNRMTFAVRERGAPGGPQHGIVTVDQRTASFIYTADPGFVGTDTFSV NVSDDTSLHVHGLAGYLGPFHGHDDVATVTVFVGNTPTDTISGDFSMLTYNIAGLPFPLS SAILPRFFYTKEIGKRLNAYYVANVQEDFAYHQFLIKKSKMPSQTPPEPPTLLWPIGVPF SDGLNTLSEFKVQRLDRQTWYECTSDNCLTLKGFTYSQMRLPGGDTVDVYNLHTNTGGGP TTNANLAQVANYIQQNSAGRAVIVTGDFNARYSDDQSALLQFAQVNGLTDAWVQVEHGPT TPPFAPTCMVGNECELLDKIFYRSGQGVTLQAVSYGNEAPKFFNSKGEPLSDHSPAVVGF HYVADNVAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Disulfobenzaldehyde-4’-nitrophenylhydrazine, Disodium Salt
D3775-53 250 mg

2,4-Disulfobenzaldehyde-4’-nitrophenylhydrazine, Disodium Salt

Sign In for Pricing
View Details
CXCR4 Rabbit Polyclonal Antibody (BF488)
orb2461182 100 µL

CXCR4 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) (MaxLight 550)
MBS6210496-01 0.1 mL

C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) (MaxLight 550)

Sign In for Pricing
View Details
C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) (MaxLight 550)
MBS6210496-02 5x 0.1 mL

C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) (MaxLight 550)

Sign In for Pricing
View Details
MAX Antibody
orb43561-01 50 µg

MAX Antibody

Sign In for Pricing
View Details
MAX Antibody
orb43561-02 100 µg

MAX Antibody

Sign In for Pricing
View Details