Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein flp (flp)

This Recombinant Staphylococcus aureus Protein flp (flp) spans the amino acid sequence from region 1-498.

Product Specifications

Product Name Alternative

Protein flp, FmtA-like protein

UniProt

Q99RJ0

Expression Region

1-498

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDKIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDD VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNNKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASILNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLTLCLCIAIALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROC1 (Regulator of Cullins 1, BA554C12.1, MGC13357, MGC1481, OTTHUMP00000028983, Protein ZYP, RING Box 1, RING Box Protein 1, Ringbox Protein 1, Rbx, 1, RING Finger Protein 75, RNF75, ZYP Protein, Hrt1) (HRP)
MBS6498086-01 0.1 mL

ROC1 (Regulator of Cullins 1, BA554C12.1, MGC13357, MGC1481, OTTHUMP00000028983, Protein ZYP, RING Box 1, RING Box Protein 1, Ringbox Protein 1, Rbx, 1, RING Finger Protein 75, RNF75, ZYP Protein, Hrt1) (HRP)

Sign In for Pricing
View Details
ROC1 (Regulator of Cullins 1, BA554C12.1, MGC13357, MGC1481, OTTHUMP00000028983, Protein ZYP, RING Box 1, RING Box Protein 1, Ringbox Protein 1, Rbx, 1, RING Finger Protein 75, RNF75, ZYP Protein, Hrt1) (HRP)
MBS6498086-02 5x 0.1 mL

ROC1 (Regulator of Cullins 1, BA554C12.1, MGC13357, MGC1481, OTTHUMP00000028983, Protein ZYP, RING Box 1, RING Box Protein 1, Ringbox Protein 1, Rbx, 1, RING Finger Protein 75, RNF75, ZYP Protein, Hrt1) (HRP)

Sign In for Pricing
View Details
Human GSTa4 ELISA Kit (Ready to Use)
orb550905-01 48 Tests

Human GSTa4 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human GSTa4 ELISA Kit (Ready to Use)
orb550905-02 96 Tests

Human GSTa4 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
CTDP1 Rabbit pAb
orb2708225-01 50 µL

CTDP1 Rabbit pAb

Sign In for Pricing
View Details
CTDP1 Rabbit pAb
orb2708225-02 100 µL

CTDP1 Rabbit pAb

Sign In for Pricing
View Details