Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human astrovirus-8 Non-structural polyprotein 1AB (ORF1)

This Recombinant Human astrovirus-8 Non-structural polyprotein 1AB (ORF1) spans the amino acid sequence from region 915-1417.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1AB, Cleaved into the following 5 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20, 7. RNA-directed

UniProt

Q9IFX2

Expression Region

915-1417

Origin

Human astrovirus-8 (HAstV-8)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAQNYHSLDAWKSLLEPPRERRCVPANFPLLGHLPINRPIFDDKKPRDDLLGLLPEPTWH AFEEYGPTTWGPQAFVKSFDKFFYAEPIDFFSEYPQLCAFADWATYREFRYLEDTRVIHI TATEKNTDSTPAYPKMNYFDTEEDYLEAHGWAPYIREFTRVFKGDKPEVLWYLFLKKEII KEEKIRNSDIRQIVCADPIYTRIGACLEAHQNALMKQHTDTSVGQCGWSPMEGGFKKTMQ RLVNKGNKHFIEFDWTRYDGTIPPALFKHIKEIRWNFINKDQREKYRHVHEWYVDNLLNR HVLLPSGEVTLQTRGNPSGQFSTPMDNNMVNFWLQAFEFAYFNGPDKDLWKTYDTVVYGD DRLSTTPSVPDNYEERVITMYRDIFGMWVKPGKVICRDSIVGLSFCGFTVNENLEPVPTS PEKLMASLLKPYKILPDLESLHGKLLCYQLLAAFMAEDHPFKVYVEHCLSRTAKQLRDSG LPARLTEEQLHRIWRGGPKKCDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM219B Rabbit Polyclonal Antibody
TA360951 100 µL

FAM219B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10
TRP-00575-01 10 mg

Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10

Sign In for Pricing
View Details
Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10
TRP-00575-02 50 mg

Exo-β-1,3-Xylosidase, Streptomyces sp. SWU10

Sign In for Pricing
View Details
GRIK1 Human shRNA Lentiviral Particle (Locus ID 2897)
TL312614V 500 µL Each

GRIK1 Human shRNA Lentiviral Particle (Locus ID 2897)

Sign In for Pricing
View Details
RALGDS (Ral Guanine Nucleotide Dissociation Stimulator, RalGDS, Ral Guanine Nucleotide Exchange Factor, RalGEF, KIAA1308, RGF, FLJ20922) (MaxLight 550)
132288-ML550 100 µL

RALGDS (Ral Guanine Nucleotide Dissociation Stimulator, RalGDS, Ral Guanine Nucleotide Exchange Factor, RalGEF, KIAA1308, RGF, FLJ20922) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human Neuron-Specific Enolase (NSE) Protein
ARP3138-01 10 µg

Recombinant Human Neuron-Specific Enolase (NSE) Protein

Sign In for Pricing
View Details