Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-9 protein (GJA9)

This Recombinant Human Gap junction alpha-9 protein (GJA9) spans the amino acid sequence from region 1-515.

Product Specifications

Product Name Alternative

Gap junction alpha-9 protein, Connexin-58, Cx58, Connexin-59, Cx59, Gap junction alpha-10 protein

UniProt

P57773

Expression Region

1-515

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDWNLLGDTLEEVHIHSTMIGKIWLTILFIFRMLVLGVAAEDVWNDEQSGFICNTEQPG CRNVCYDQAFPISLIRYWVLQVIFVSSPSLVYMGHALYRLRVLEEERQRMKAQLRVELEE VEFEMPRDRRRLEQELCQLEKRKLNKAPLRGTLLCTYVIHIFTRSVVEVGFMIGQYLLYG FHLEPLFKCHGHPCPNIIDCFVSRPTEKTIFLLFMQSIATISLFLNILEIFHLGFKKIKR GLWGKYKLKKEHNEFHANKAKQNVAKYQSTSANSLKRLPSAPDYNLLVEKQTHTAVYPSL NSSSVFQPNPDNHSVNDEKCILDEQETVLSNEISTLSTSCSHFQHISSNNNKDTHKIFGK ELNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPR WLRATWGSSTEHENRGSPPKGNLKGQFRKGTVRTLPPSQGDSQSLDIPNTADSLGGLSFE PGLVRTCNNPVCPPNHVVSLTNNLIGRRVPTDLQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNKS1BP1 activation kit by CRISPRa
GA113895 1 Kit

Human TNKS1BP1 activation kit by CRISPRa

Sign In for Pricing
View Details
NKAIN2 (NM_153355) Human Over-expression Lysate
LC432577 20 µg

NKAIN2 (NM_153355) Human Over-expression Lysate

Sign In for Pricing
View Details
mIgG2a Fcγ Fragment Specific Rabbit monoclonal antibody,clone OTIR9D3
TA592582 100 µL

mIgG2a Fcγ Fragment Specific Rabbit monoclonal antibody,clone OTIR9D3

Sign In for Pricing
View Details
Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-,  20nm
GP-6301-20 1 mL

Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 20nm

Sign In for Pricing
View Details
Human WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) ELISA Kit
RDR-WWP2-Hu-01 96 Tests

Human WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) ELISA Kit

Sign In for Pricing
View Details
Human WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) ELISA Kit
RDR-WWP2-Hu-02 48 Tests

Human WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) ELISA Kit

Sign In for Pricing
View Details