Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Vang-like protein 2-A (vangl2-a)

This Recombinant Xenopus laevis Vang-like protein 2-A (vangl2-a) spans the amino acid sequence from region 1-521.

Product Specifications

Product Name Alternative

Vang-like protein 2-A, Protein strabismus-A, Van Gogh-like protein 2-A, Xstrabismus-A, Xstbm-A

UniProt

Q90X64

Expression Region

1-521

Origin

Xenopus laevis (African clawed frog)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNDSQYSGYSYKSGHSRSSRKHRDRRERHRSKSREGSRGDKSVTIQAPGEPLLDNESTR GEDRDDNWGETTTVVTGTSEHSISHDDITRITKDMEDSAKLDCSRHLGVVIGGALALLSF LTPIAFMLLPQILWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFV FRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELR QLQPQFTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK KMSGFKVYSLGEENTTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLV VAVEEAFTHIKRLQDEDQKNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LHHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVL KRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF488A conjugate, 0.1mg/mL
BNC882066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF405S conjugate, 0.1mg/mL
BNC040755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL
BNC881859-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL
BNC402759-100 1x 100 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details