Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vang-like protein 2 (VANGL2)

This Recombinant Human Vang-like protein 2 (VANGL2) spans the amino acid sequence from region 1-521.

Product Specifications

Product Name Alternative

Vang-like protein 2, Loop-tail protein 1 homolog, Strabismus 1, Van Gogh-like protein 2

UniProt

Q9ULK5

Expression Region

1-521

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Welwitschia mirabilis Photosystem II CP43 chlorophyll apoprotein (psbC)
MBS7027568-01 0.02 mg

Recombinant Welwitschia mirabilis Photosystem II CP43 chlorophyll apoprotein (psbC)

Sign In for Pricing
View Details
Recombinant Welwitschia mirabilis Photosystem II CP43 chlorophyll apoprotein (psbC)
MBS7027568-02 0.1 mg

Recombinant Welwitschia mirabilis Photosystem II CP43 chlorophyll apoprotein (psbC)

Sign In for Pricing
View Details
Recombinant Welwitschia mirabilis Photosystem II CP43 chlorophyll apoprotein (psbC)
MBS7027568-03 5x 0.1 mg

Recombinant Welwitschia mirabilis Photosystem II CP43 chlorophyll apoprotein (psbC)

Sign In for Pricing
View Details
Rabbit Monoclonal ERK1/ERK2 [p Tyr187, p Tyr204, p Thr185, p Thr202] Antibody (269434) [Janelia Fluor 646]
FAB1018J 0.1 mL

Rabbit Monoclonal ERK1/ERK2 [p Tyr187, p Tyr204, p Thr185, p Thr202] Antibody (269434) [Janelia Fluor 646]

Sign In for Pricing
View Details
1-Methylnicotinamide chloride
S3346-1g 1 g

1-Methylnicotinamide chloride

Sign In for Pricing
View Details
DEFB131-set siRNA/shRNA/RNAi Lentivector (Human)
17954091 4x 500 ng

DEFB131-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details