Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vang-like protein 2 (VANGL2)

This Recombinant Human Vang-like protein 2 (VANGL2) spans the amino acid sequence from region 1-521.

Product Specifications

Product Name Alternative

Vang-like protein 2, Loop-tail protein 1 homolog, Strabismus 1, Van Gogh-like protein 2

UniProt

Q9ULK5

Expression Region

1-521

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HLA specific IgG antibody (HLA-sIgG) ELISA Kit
YP-W15881-01 48 Tests

Human HLA specific IgG antibody (HLA-sIgG) ELISA Kit

Sign In for Pricing
View Details
Human HLA specific IgG antibody (HLA-sIgG) ELISA Kit
YP-W15881-02 96 Tests

Human HLA specific IgG antibody (HLA-sIgG) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis Mb2009 Protein (aa 38-142)
VAng-Yyj3048-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Bovis Mb2009 Protein (aa 38-142)

Sign In for Pricing
View Details
Small nuclear ribonucleoprotein Sm D2 Antibody (Biotin)
abx105924-01 20 µg

Small nuclear ribonucleoprotein Sm D2 Antibody (Biotin)

Sign In for Pricing
View Details
Small nuclear ribonucleoprotein Sm D2 Antibody (Biotin)
abx105924-02 50 µg

Small nuclear ribonucleoprotein Sm D2 Antibody (Biotin)

Sign In for Pricing
View Details
Small nuclear ribonucleoprotein Sm D2 Antibody (Biotin)
abx105924-03 100 µg

Small nuclear ribonucleoprotein Sm D2 Antibody (Biotin)

Sign In for Pricing
View Details