Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vang-like protein 2 (Vangl2)

This Recombinant Rat Vang-like protein 2 (Vangl2) spans the amino acid sequence from region 1-521.

Product Specifications

Product Name Alternative

Vang-like protein 2, Van Gogh-like protein 2

UniProt

P84889

Expression Region

1-521

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGSRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGAILALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Human KRAS (G12C, Y96D) BaF3 Cell Line
S01YF-0324-KX204 1 Vial

Magic™ Human KRAS (G12C, Y96D) BaF3 Cell Line

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2150968-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2150968-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2150968-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2150968-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2150968-05 5 mL

APC_Cy7-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details