Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ovine astrovirus 1 Non-structural polyprotein 1AB (ORF1)

This Recombinant Ovine astrovirus 1 Non-structural polyprotein 1AB (ORF1) spans the amino acid sequence from region 827-1351.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1AB, Cleaved into the following 5 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20, 7. RNA-directed

UniProt

Q9JH66

Expression Region

827-1351

Origin

Ovine astrovirus 1 (OAstV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPKKLQRGPEDPGPEECKLDYWEQLVEPSKEKFLVPPEYPLLGVVPLDRPISDFDAPVDN LLALLPEPESPDLGFEPAVWGPEAYVKSFEKFDFADPDPNIEKNYPREWAFANLVLHREF DFLADSVVKDITATSKNSESTPGFPKTYWWKTEAEYLAKRGYADYVSEWNRIRGGARPNV LWYLFLKKEILKSTKVRDADIRQIICSDPIFARIGCCFEEDQNERMKRRTKTRMPQCGWS PFFGGFNDRIQRLVAKGNPYWIEFDWTRYDGTIPSQIFKHIKNFRFSMLAKEYQTPELRN MYHWYVDNILRRYVCMPSGEITIQHKGNPSGQVSTTMDNNLVNVFLQAFEYAYLHPEKSM DELRKDWESYDSLIYGDDRLTTSPSVPNDYVTRVVAMYKDIFGMWVKPEKVKVSHSPVGL SFCGFVITHQDGQYLPVPAEEAKLLASLLRPTKKLENMDALYGKLLCYRILNHNLPNDNK FRNYILVALEVMARHYSSRGEEPPFYVTESMLDKLWRGGPKFDYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details