Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyamopsis tetragonoloba Mannan synthase 1 (ManS)

This Recombinant Cyamopsis tetragonoloba Mannan synthase 1 (ManS) spans the amino acid sequence from region 1-526.

Product Specifications

Product Name Alternative

Mannan synthase 1, EC= 2.4.1.-, CtManS

UniProt

Q6UDF0

Expression Region

1-526

Origin

Cyamopsis tetragonoloba (Guar) (Cluster bean)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNLIFEEPEGIPGNSSSSLRYAWQSIRAPVIIPLLKLAVIVCSVMSIMLFVERVAMAAV ILIVKVLRKKRYTKYNLEAMKQKLERSKKYPMVLIQIPMYNEKEVYKLSIGAVCGLSWPA DRFIVQVLDDSTNPVLRELVEMECQKWIQKGVNVKYENRRNRNGYKAGALKEGLEKQYVE DCEFVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSEECMMTRLQEMSLDYH FSVEQEVGSSTYSFFGFNGTAGVWRIQAIKDAGGWKDRTTVEDMDLAVRASLHGWEFVFV GDVKVKNELPSTFKAYRFQQHRWSCGPANLFKKMTKEIICCKRVPLLKRLHLIYAFFFVR KIVAHWVTFFFYCIVIPACVIVPEVNLKKQIAIYIPATITILNAVSTPRSMHLLVLWILF ENVMSLHRTKAAIIGLLEANRVNEWVVTEKLGNAMKQRNNARPSRASRFRIIERIHPLEI IVGMYMLHCATYDLLFGHDHFFVYLLLQAGAFFTMGFGLVGTIVPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF405S conjugate, 0.1mg/mL
BNC040967-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF568 conjugate, 0.1mg/mL
BNC682746-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), Biotin conjugate, 0.1mg/mL
BNCB0806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details