Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Membrane protein insertase YidC (yidC)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-528.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q9PNX7

Expression Region

1-528

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNSNNIFQQKRILLAVVISFLFFVIYDYFFIPKQPLKIEQNITQKNQQNTSINNTPNIQ NATTNTPSAALVSQDSVISKVQSKHFEAQIDSFGRISAFYLKDRKYQNEKGEFINLVSKE NSPYPLEMRFSDPSINSEAFKIPYVANASNLFVDENGSQVLKLTQNLSGLKIEKDITFYP KGNYEIEVKLSKNANYFISPGYRPNIAVDSYTVHGALVMDNKETIETYKDGDVEKDESAN NVVMTSAFDRYYATFFYNFDKPLNVAISKDANQNPIVFAYSDNEFKAGGYIGSKEHVILR SIDPRLEAVVEYGWFTFIAKPMFEFLNFLHQYIGNWGWAIVVMTLIVRIILFPLTYKSMI SMNKLKDLAPKMKDIRERYKGDPQKMNMHMMELYKKHGANPMSGCLPILLQIPIFFAIYR VLLNAIELKAAPWAFWIHDLSVMDPYFILPILMGATMFLQQLITPMTIQDPMQAKIMKFL PVIFTFFFITFPAGLTLYWFVNNLCSLVQQWVINKIFAKEHHKKTSGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Scavenger Receptor B2/SR-B2/LIMPII/CD36L2 (C-Fc)
CP14-500ug 500 µg

Recombinant Mouse Scavenger Receptor B2/SR-B2/LIMPII/CD36L2 (C-Fc)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen, Recombinant (HBsAg)
H1909-08Z3-01 50 µg

Hepatitis B Surface Antigen, Recombinant (HBsAg)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen, Recombinant (HBsAg)
H1909-08Z3-02 100 µg

Hepatitis B Surface Antigen, Recombinant (HBsAg)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen, Recombinant (HBsAg)
H1909-08Z3-03 250 µg

Hepatitis B Surface Antigen, Recombinant (HBsAg)

Sign In for Pricing
View Details
Mouse Monoclonal RHOBTB2 Antibody (DBC2/3362) [Alexa Fluor 488]
NBP3-08659AF488 100 µL

Mouse Monoclonal RHOBTB2 Antibody (DBC2/3362) [Alexa Fluor 488]

Sign In for Pricing
View Details
Dmkn sgRNA CRISPR Lentivector set (Rat)
K6242201 3x 1.0 µg

Dmkn sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details