Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-532.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

B8D8H9

Expression Region

1-532

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVQRNFFIFAFLFVSFLLWQAWQSQMFLNKKTNEKIDPIFHFIDVKKNKKKIFIKNDVI SLVVNMYGGDVEEASLLAYKDTLYSSRPFKLLETGSDFIYQAQSGLIGKDGPDSSINDSR PLYSANKNFFVLGPNEKELRVPIKWVSKNGVIYKKTFILKPNRYDVQIEYDVYNPSKESL NMNIFGQIKQTINLPKKRNVYSGNFALQTFRGAAYSSDDNKYEKYKFDMIANNKNLHIMT ESGWIAMLQQYFAVAWIPDNLGKNTIYTSSLDHDTAVIGYKSPIINIPPNSRSIIKSKLW IGPEIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTILYSIIGNWGFSIILITFIMRGL TYPLTKAQYISMAKMRALQPKIQEIKEKFSKDKQRISQEMILLYKKEKINPLGGFLPIFI QMPIFLSLYYMLIGSVELRHAPFLLWIHDLSSQDPYYVLPVIMGLTMFFIQKISSTNHIS DPLQKKIMNFMPVIFTAFFLWFPSGLVLYYIISNLVTIIQQKFILSNLEKNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
18743126 3x 1.0µg DNA

DVL1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human  IgG powder ≥ 97% purity
SLH56-0010 10 g

Human IgG powder ≥ 97% purity

Sign In for Pricing
View Details
Large Multifunctional Peptidase 7 (LMP7) Recombinant, Human
155614-01 10 µg

Large Multifunctional Peptidase 7 (LMP7) Recombinant, Human

Sign In for Pricing
View Details
Large Multifunctional Peptidase 7 (LMP7) Recombinant, Human
155614-02 50 µg

Large Multifunctional Peptidase 7 (LMP7) Recombinant, Human

Sign In for Pricing
View Details
Large Multifunctional Peptidase 7 (LMP7) Recombinant, Human
155614-03 200 µg

Large Multifunctional Peptidase 7 (LMP7) Recombinant, Human

Sign In for Pricing
View Details
GCP4 Rabbit pAb, PE-Cy5 conjugated
orb2883099 100 µL

GCP4 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details