Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-532.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

B8D6T3

Expression Region

1-532

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVQRNFFIFAFLFVSFLLWQAWQSQMFLNKKTNEKIDPIFHFIDVKKNKKKIFIKNDVI SLVVNMYGGDVEEASLLAYKDTLYSSRPFKLLETGSDFIYQAQSGLIGKDGPDSSINDSR PLYSANKNFFVLGPNEKELRVPIKWLSKNGVIYKKTFILKPNRYDVQIEYDVYNPSKESL NMNIFGQIKQTINLPKKRNVYSGNFALQTFRGAAYSSDDNKYEKYKFDMIANNKNLHIMT ESGWIAMLQQYFAVAWIPDNLGKNTIYTSSLDHDTAVIGYKSPIINIPPNSRSIIKSKLW IGPEIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTILYSIIGNWGFSIILITFIMRGL TYPLTKAQYISMAKMRALQPKIQEIKEKFSKDKQRISQEMILLYKKEKINPLGGFLPIFI QMPIFLSLYYMLIGSVELRHAPFLLWIHDLSSQDPYYVLPVIMGLTMFFIQKISSTNHIS DPLQKKIMNFMPVIFTAFFLWFPSGLVLYYIISNLVTIIQQKFILSNLEKNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurite Outgrowth Inhibitor (RTN4, Reticulon-4, Foocen, Nogo Protein, Neuroendocrine-specific Protein, NSP, Neuroendocrine-specific Protein C Homolog, RTN-x, Reticulon-5, KIAA0886, NOGO, My043, SP1507) discontinued
N2116-41D 50 µg

Neurite Outgrowth Inhibitor (RTN4, Reticulon-4, Foocen, Nogo Protein, Neuroendocrine-specific Protein, NSP, Neuroendocrine-specific Protein C Homolog, RTN-x, Reticulon-5, KIAA0886, NOGO, My043, SP1507) discontinued

Sign In for Pricing
View Details
Msln (NM_031658) Rat Tagged ORF Clone
RR206861 10 µg

Msln (NM_031658) Rat Tagged ORF Clone

Sign In for Pricing
View Details
(1-Chlorocyclohexyl) methanamine hydrochloride
SBA00983-01 50 mg

(1-Chlorocyclohexyl) methanamine hydrochloride

Sign In for Pricing
View Details
(1-Chlorocyclohexyl) methanamine hydrochloride
SBA00983-02 0.5 g

(1-Chlorocyclohexyl) methanamine hydrochloride

Sign In for Pricing
View Details
Human MEP1A Pre-designed siRNA Set B
SI009461B 1 Each

Human MEP1A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-mGluR1 Antibody
24540 100 µL

Anti-mGluR1 Antibody

Sign In for Pricing
View Details