Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Membrane protein insertase YidC (yidC)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-536.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q89B34

Expression Region

1-536

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLQRNFFILIFFFISFLLWKTWQQKEFSSDVHKIINKYENVNLVNNNINKLASNIIIKT DVLKIQVNLYGGDIEKAELLHFKSKLNSSQSLVLLDTNENFVYQAQCGITGKDGADNLQK HIRPLYIAKRKYYELSRHNKKIEVPLQWISKDGIIYKKIFVLKSGEYDVSVKYKINNITN KHLKVSMFGQLKQTINLPEDKNTYTNNFALQTFRGAAYSSDNDKYVKYSFDSIVNKEKKN IVVTHSGWVAMLQKYFATSWIPDNSYLNTMYIGSSGDNLAEIGYYSRPIDIFPHSTISLS SKLWIGPEIQNKMAVIASNLDLTVDYGWLWFLSQPLFKLLNFLYNICGNWGVSIILITFI IKGITFPLTKSQFKTMAKIRKLQPKINYIKKKFKNNNQKISEEIMSLYKTEKVNPLGGCF PLFIQMPIFLALYYMLISSVELRHAPFFLWIHDLSDQDPFYVLPILMGVTMFFIQRVTPS NVTDPVQKKIMNYIPILFTVFFLWFPSGLVLYYLISNLVTIIQQKIIIKALNKTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details