Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus succinogenes Membrane protein insertase YidC (yidC)

This Recombinant Actinobacillus succinogenes Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-537.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A6VR61

Expression Region

1-537

Origin

Actinobacillus succinogenes (strain ATCC 55618 / 130Z)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSRSLLALALLFISFLVYQQWEIDKAPKPVVRETAVSQSDTPNSSSASTSAVDSQAKG RVITLQNDVFRLKVDTLGGDVIESELLNYAQELNGEERFTLLENKDGTTYVAQSGLVGKN GIDSAAGRADYQVNGDNFVLAEGQDELSVPFTFEKDGVIYRKIFMLKRGSYDIAVNYEIR NQSDETIEVQPYGQLKHTLVESSGSMAMPTYTGGAYSSSETNYKKYSFDDMKGANLSVNT KAGWVAVLQHYFVSAWIPNQDADNQLYTTTNNGMGFIGFRGPTVTVPAGATETVKTALWT GPKLQNQMGEVAEHLDLTVDYGWAWFIAKPLFALLTLIQSLVSNWGLAIIGVTLVVKAIL YPLTKAQYTSMAKMRMLQPKLQEMRERFGDDRQRMSQEMMKLYKEEKVNPLGGCLPLLIQ MPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYILPLLMGGSMFLLQKLSPTPVADP MQQKVMNFMPVIFTVFFLWFPAGLVLYWLVSNVITIIQQQLIYRGLEKKGLHSRKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL
BNC882479-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL
BNC041950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF488A conjugate, 0.1mg/mL
BNC880052-100 1x 100 µL

HCG-intact (HCGab/52), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details