Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-540.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q87TR5

Expression Region

1-540

Origin

Vibrio parahaemolyticus

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSQRNILLIALALVSFLLFQQWQVAKNPAPQAVEQAQSSSSLPAPSFADELDPVPGQQQ ASAKTITVTTDVLTLSIDTVGGDVVHADLNQYSAELDSSDPFVLLKDTQGHQFIAQSGLV GPQGIDLSSSNRPHYNVSADSFTLADGQDELRVPMTFTANGIEYTKTYVLKRGSYALNVE YDVANNSGNNATFGMYAHLRQNLMDAGGSITMPTYRGGAYSTEDTRYKKYSFEDMQDRNL SINLADGQGWAAMIQHYFAAAWIPRNEPGTNLYTRVIGNLGDIGVRMPNKTIATGDQAKF EATLWVGPKLQQEMAAVAPNLDLVVDYGWLWFIAKPLHSLLAFIQSFVGNWGVAIICLTF IVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQRMSQEMMELYKKEKVNPLGGC LPLVLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYYILPLLMGASMFLIQKMSP TTVTDPMQQKIMTFMPVMFTFFFLFFPSGLVLYWLVSNIVTLIQQTLIYKALEKKGLHTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B3]
TA500960AM 100 µL

BHMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B3]

Sign In for Pricing
View Details
Ms Medium (Free Of Organic Elements, Agar And Sucrose)
LB0090 250 g

Ms Medium (Free Of Organic Elements, Agar And Sucrose)

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor Polyclonal Antibody
bs-23774R 100 µL

Angiotensin II Type 1 Receptor Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Lipopolysaccharide core heptose (II)-phosphate phosphatase
MBS1143422-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Lipopolysaccharide core heptose (II)-phosphate phosphatase

Sign In for Pricing
View Details
Recombinant Escherichia coli Lipopolysaccharide core heptose (II)-phosphate phosphatase
MBS1143422-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Lipopolysaccharide core heptose (II)-phosphate phosphatase

Sign In for Pricing
View Details
Recombinant Escherichia coli Lipopolysaccharide core heptose (II)-phosphate phosphatase
MBS1143422-03 0.02 mg (Yeast)

Recombinant Escherichia coli Lipopolysaccharide core heptose (II)-phosphate phosphatase

Sign In for Pricing
View Details