Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus parasuis serovar 5 Membrane protein insertase YidC (yidC)

This Recombinant Haemophilus parasuis serovar 5 Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-546.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

B8F6M2

Expression Region

1-546

Origin

Haemophilus parasuis serovar 5 (strain SH0165)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSNRSLLIMGLLLVSFLIFTQWQQDYNPEIQAQKQAMAQAQTQQVANQSSDVPASSNAA SINEQSTKGKTITIETDVLRLTVDTLGGDVVDSDLLKYNAELDSNTPFELLQDNGKVLYV AQSGLVGKNGIDTTAGRAQYQATAEKFALAEGQDEIALPLTFEKDGVVYTKTFTLKRGSY NVAVNYHIKNGTAETLEVQPYGQLKHTLVESTGNFAMPTYTGGAYSSSEVNYKKYSFDEM AKANLSVDTKAGWAAVLQHYFVSAWIPNQDAENNLYTRTGNGVGTIGYRGPVTQVAPNGE ATITSHLWTGPKDQAAMAQVANNFDLTVDYGWAWFIAKPLFWLLTFIQSIVSNWGLAIIG VTIVVKTILYPLTKAQYTSMAKMRMLQPRIQEMRERFGDDRQRMSQEMMKLYKEEKVNPM GGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYIFPLLMGGSMYLLQK MSPTPIADPVQQKVMNFMPVMFTVFFLWFPSGLVLYWLTSNLITIAQQWLIYRNLEKKGL HTRVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF488A conjugate, 0.1mg/mL
BNC882366-500 1x 500 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF740 conjugate, 0.1mg/mL
BNC742324-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF740 conjugate, 0.1mg/mL
BNC741284-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF640R conjugate, 0.1mg/mL
BNC402010-100 1x 100 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF405S conjugate, 0.1mg/mL
BNC042409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details