Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-548.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

P65624

Expression Region

1-548

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Erythropoietin (EPO) ELISA Kit, PRO
CEA-C027-480tests 480 Tests

Human Erythropoietin (EPO) ELISA Kit, PRO

Sign In for Pricing
View Details
Influenza A H1N1 (A/England/195/2009) Hemagglutinin / HA Protein (His Tag)
E45O54381M2-100 100 µg

Influenza A H1N1 (A/England/195/2009) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
OSTM1 CRISPR Activation Plasmid (m)
sc-420572-ACT 20 µg

OSTM1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (MaxLight 405) discontinued
S1013-57E7-ML405 100 µL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (MaxLight 405) discontinued

Sign In for Pricing
View Details
L-Glutamic acid g-7-amido-4-methylcoumarin 99+% (HPLC)
239249-01 100 mg

L-Glutamic acid g-7-amido-4-methylcoumarin 99+% (HPLC)

Sign In for Pricing
View Details
L-Glutamic acid g-7-amido-4-methylcoumarin 99+% (HPLC)
239249-02 250 mg

L-Glutamic acid g-7-amido-4-methylcoumarin 99+% (HPLC)

Sign In for Pricing
View Details