Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thiobacillus denitrificans Lipid A export ATP-binding/permease protein MsbA (msbA)

This Recombinant Thiobacillus denitrificans Lipid A export ATP-binding/permease protein MsbA (msbA) spans the amino acid sequence from region 1-579.

Product Specifications

Product Name Alternative

Lipid A export ATP-binding/permease protein MsbA, EC= 3.6.3.-

UniProt

Q3SFZ6

Expression Region

1-579

Origin

Thiobacillus denitrificans (strain ATCC 25259)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAPTSRHLYGRLLGYVKPHWRMFALSIVGLILTAATEPMLPALFKPLLDEGFVAKDQDF IRWVPLLLLGLFVLRGVASFISTYSMAWVGSRLVMDLRAAMFDKLMALPTRYFDQNPSGQ LIAQLAFNVTQVTQSATSSLTTLVRDTVTVLGLLGYLVWLNWRLTLIVFALVPLTLWVVR VASKRLRGLSRKAQENIGDLTQVVDEAVGGHRVVKLYGGETYEQARFHRAANLARQFEMK RVAANAVYEPVIQFIAAIALAIIVFIAAGQASANTTTVGGFVAFFMAMLLLFAPLKRLTA VNDQLQRGLAASETIFALLDQDAERDTGTREPAHIEGRLAFRDVGLTYPGKQTPALARIS LDIAPGETVALVGASGSGKTTLANLVPRFYDPDAGRIELDGVDIRDVKLQSLRGHIALVS QDVVLFNDTLAHNIAYGSKREASPDEIRAACVAAHAWDFIQAMPDGLDTLIGENGMRLSG GQRQRIAIARAILKNAPILILDEATSALDSESERHVQAALETLMQNRTTLVIAHRLSTIE RANRIVVLEGGRIVETGAHADLLAKQGRYAQLHALQFSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (PE)
MBS6340607-01 0.2 mL

RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (PE)

Sign In for Pricing
View Details
RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (PE)
MBS6340607-02 5x 0.2 mL

RBAK, NT (RBAK, ZNF769, RB-associated KRAB zinc finger protein, RB-associated KRAB repressor, Zinc finger protein 769) (PE)

Sign In for Pricing
View Details
ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (Biotin)
MBS6171729-01 0.1 mL

ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (Biotin)

Sign In for Pricing
View Details
ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (Biotin)
MBS6171729-02 5x 0.1 mL

ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (Biotin)

Sign In for Pricing
View Details
ELISA kit for Rat Replication protein A 70 kDa DNA-binding subunit (RPA1)
KTE100972-01 48 Tests

ELISA kit for Rat Replication protein A 70 kDa DNA-binding subunit (RPA1)

Sign In for Pricing
View Details
ELISA kit for Rat Replication protein A 70 kDa DNA-binding subunit (RPA1)
KTE100972-02 96 Tests

ELISA kit for Rat Replication protein A 70 kDa DNA-binding subunit (RPA1)

Sign In for Pricing
View Details