Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Lipid A export ATP-binding/permease protein MsbA (msbA)

This Recombinant Shigella sonnei Lipid A export ATP-binding/permease protein MsbA (msbA) spans the amino acid sequence from region 1-582.

Product Specifications

Product Name Alternative

Lipid A export ATP-binding/permease protein MsbA, EC= 3.6.3.-

UniProt

Q3Z3K7

Expression Region

1-582

Origin

Shigella sonnei (strain Ss046)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDNLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAIDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNH7 CRISPRa sgRNA lentivector (set of three targets)(Human)
25366121 3x 1.0µg DNA

KCNH7 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human KIR3DL2 (Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3905K Each

Magic™ Membrane Protein Human KIR3DL2 (Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Fam103a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7462107 1.0 µg DNA

Fam103a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Cyclo (-Ala-Ser)
sc-285310A 1 g

Cyclo (-Ala-Ser)

Sign In for Pricing
View Details
MAP2K4 Polyclonal Antibody
MBS2575091-01 0.06 mL

MAP2K4 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K4 Polyclonal Antibody
MBS2575091-02 0.12 mL

MAP2K4 Polyclonal Antibody

Sign In for Pricing
View Details