Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Lipid A export ATP-binding/permease protein MsbA (msbA)

This Recombinant Haemophilus influenzae Lipid A export ATP-binding/permease protein MsbA (msbA) spans the amino acid sequence from region 1-587.

Product Specifications

Product Name Alternative

Lipid A export ATP-binding/permease protein MsbA, EC= 3.6.3.-

UniProt

Q4QPI4

Expression Region

1-587

Origin

Haemophilus influenzae (strain 86-028NP)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQEQKLQENDFSTLQTFKRLWPMIKPFKAGLIASGIALVFNALADSGLIYLLKPLLDDGF GKANHSFLKIMAFVVVGMIILRGVTNFISNYCLAWVSGKVVMTMRRRLFKHLMFMPVSFF DRNSTGKLLSRITYDSEMIASSSSGSLITIVREGAYIISLLAVMFYTSWELTLVLFVIGP IIAVLITIVSKIFRKLSKNLQDSMGELTATTEQMLKGHKVVISFGGQFVEEERFNKVSNN MRRKGMKMVTADSISDPVVQIIASLALVAVLFLATTPLIAEDNLSAGSFTVVFSSMLAMM RPLKSLTNVNSQFQRGMAACQTLFAILDLEPEKDNGTYKAEPAKGALEFKNVSFAYQGKE ELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNL RENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIG ENGASLSGGQRQRLAIARALLRNSPVLILDEATSALDTESERAIQSALDELKKDRTVIVI AHRLSTIENADEILVIDHGEIRERGNHKALLEQNGAYKQLYSMQFSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Anti-TFPI (befovacimab biosimilar) mAb
12-90070B-50 50 µg

Biotinylated Anti-TFPI (befovacimab biosimilar) mAb

Sign In for Pricing
View Details
Lentiviral human B3GALNT1 shRNA (UAS) - Lentiviral human B3GALNT1 shRNA (UAS, iRFP) (25)
GTR15311957 1 Vial

Lentiviral human B3GALNT1 shRNA (UAS) - Lentiviral human B3GALNT1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)
orb2913978-01 20 µg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)
orb2913978-02 100 µg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial
MBS1236909-01 0.05 mg (E-Coli)

Recombinant DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial

Sign In for Pricing
View Details
Recombinant DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial
MBS1236909-02 0.05 mg (Yeast)

Recombinant DNA-directed RNA polymerase I subunit RPA2 (RPA2), partial

Sign In for Pricing
View Details