Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. vesicatoria Lipid A export ATP-binding/permease protein MsbA (msbA)

This Recombinant Xanthomonas campestris pv. vesicatoria Lipid A export ATP-binding/permease protein MsbA (msbA) spans the amino acid sequence from region 1-589.

Product Specifications

Product Name Alternative

Lipid A export ATP-binding/permease protein MsbA, EC= 3.6.3.-

UniProt

Q3BTC8

Expression Region

1-589

Origin

Xanthomonas campestris pv. vesicatoria (strain 85-10)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTISTDRPAPVSSWRTYRRLLAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGVAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAVKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAQLLQAADQTLSSHQEVKIYGAQQTEMERYGALANR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGTVPLTRAKGLIEFRDVTARYPGQVN PALADVSFVAQPGTVTAIVGRSGSGKSSLIKLIPRFYEAEAGQILLDGHPVQAYALADLR RQIALVGQQVMLFDGSIADNVAFGEMRNADAGQLERAILGANAMEFVAQLPEGLQSHVGT KGGRLSGGQRQRLAIARAMLKDAPVLILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHQLLAQGGLYSHLHGMQFRERQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM160B1 Lentiviral Activation Particles (h2)
sc-408267-LAC-2 200 µL

FAM160B1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Krt8 siRNA Oligos set (Mouse)
26049174 3x 5 nmol

Krt8 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
ERα (phospho Tyr537) Polyclonal Antibody
E20-60648 100 µg

ERα (phospho Tyr537) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein) ELISA Kit
MBS8806583-01 48 Well

Mouse ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein) ELISA Kit
MBS8806583-02 96 Well

Mouse ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein) ELISA Kit
MBS8806583-03 5x 96 Well

Mouse ARNTL (Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein) ELISA Kit

Sign In for Pricing
View Details