Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Membrane protein insertase YidC (yidC)

This Recombinant Paracoccus denitrificans Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-635.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A1B0E4

Expression Region

1-635

Origin

Paracoccus denitrificans (strain Pd 1222)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQDNNRNLILAMVLSALVMLVWSIFFAPEPVPPAQDTPAASTQGTAQPEAGGPATPGAVP QGAAPELEAAAASSDPSANAGRVAIESSSLAGTISLAGGRIDDLELTGYRETLDTRSPFV RLLSPTAQTTVQAEGSPVAPGGGAELAVQKPYYAVYGWMPAAGTDPALVPGPATVWEVES GAKLGPGQPVTLRWDNGAGQIFRRTYELDDKFLFTVTQTLENTGTAPFSAAPYGILARHG KPDTQNFFVLHEGAVGMTDGKLLEKKYKDMTKLDPLPGEGPAELVEVQENGWIGFTDKYW MTTLAPAPGQSFTAVAKYAPGADIYQTEARMPVQTVAPGATGTSSSYLFAGAKVWEVING YQTNPGIDRFVDSIDWGWFYFLTKPIFRLLHWLHGMIGNMGWAIIALTFVLKLLVFPLAR KSYISMAKMKELQPQMEAIKERTGDDRMKFQKEVMELYKREKVNPAAGCLPVLLQIPIFF ALYKVIFVTIELRHAPWIGWIRDLAAPDPSSLWNLFGLLPWAAPGQGSFLHSFTLPVLAI LLGVSMWMQQKLNPAPTDPAQKMIFAWMPWVFMFMLGGFASGLVLYWITNNTITIIQQYT IMSMHGHRPDFFGNIRSSLPSRAKAGDKGGDKGGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRC1, NT (KLRC1, NKG2A, NKG2-A/NKG2-B type II integral membrane protein, CD159 antigen-like family member A, NK cell receptor A, NKG2-A/B-activating NK receptor, CD159a) (APC) discontinued
037578-APC 200 µL

KLRC1, NT (KLRC1, NKG2A, NKG2-A/NKG2-B type II integral membrane protein, CD159 antigen-like family member A, NK cell receptor A, NKG2-A/B-activating NK receptor, CD159a) (APC) discontinued

Sign In for Pricing
View Details
Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials
MBS2088493-01 5x 96 Tests

Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials
MBS2088493-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials
MBS2088493-03 10x 96 Tests

Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials
MBS2088493-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

Rat Paraoxonase 1 (PON1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
SDC4 (SYND4, Amphiglycan, Ryudocan Core Protein, Syndecan-4, MGC22217) (MaxLight 750) discontinued
133056-ML750 100 µL

SDC4 (SYND4, Amphiglycan, Ryudocan Core Protein, Syndecan-4, MGC22217) (MaxLight 750) discontinued

Sign In for Pricing
View Details