Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae Type IV secretion system-coupling protein virD4 (virD4)

This Recombinant Bartonella henselae Type IV secretion system-coupling protein virD4 (virD4) spans the amino acid sequence from region 1-639.

Product Specifications

Product Name Alternative

Type IV secretion system-coupling protein virD4

UniProt

Q6G2A8

Expression Region

1-639

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYTKTQLALISMPIASGALTIFLVPHMLSFVINDLKTNQIYWYVRSEPLLTLMLVAAVS LFYTLSQKLHLRKAITFVSTAFFCITALYYIGSEIKRLNPYVGQQGITWGYALKFMDPMV VFGVILGFVLLAIQVIITSPRTSNVKRAKKGIFGDAAWMNLKEAARIFPSNGQIVIGERY RVDQDNVRNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVPTCL TYTGPIVCLDPSTEIAPMVKFARKKMGNRNVIILDPNSLLTKNFNVLDWLLDENIPRTRR EANIVSFSKLLLSEKKSENSSAEYFSTQAHNLLTALLAHVIFSDKYEDSERNLKTLRAIL SQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL VCGNDFASSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVL DEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAI KDLQTAKDISERCGQMTIEVTGTSKSRGLSLTKGSQNINYQQRALILPHEIIQEMRQDEQ IILMQGHPPLRCGRAIYFRRKEMLAATEKNRFAPQAKKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MMP-9 ELISA Kit
MBS8579180-01 48 Tests

Human MMP-9 ELISA Kit

Sign In for Pricing
View Details
Human MMP-9 ELISA Kit
MBS8579180-02 96 Tests

Human MMP-9 ELISA Kit

Sign In for Pricing
View Details
Human MMP-9 ELISA Kit
MBS8579180-03 5x 96 Tests

Human MMP-9 ELISA Kit

Sign In for Pricing
View Details
CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 490)
MBS6444639-01 0.1 mL

CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 490)

Sign In for Pricing
View Details
CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 490)
MBS6444639-02 5x 0.1 mL

CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 490)

Sign In for Pricing
View Details
SNAT1 Mouse Monoclonal Antibody
orb2957645-01 50 µg

SNAT1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details