Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bestrophin-3 (Best3)

This Recombinant Mouse Bestrophin-3 (Best3) spans the amino acid sequence from region 1-669.

Product Specifications

Product Name Alternative

Bestrophin-3, Vitelliform macular dystrophy 2-like protein 3

UniProt

Q6H1V1

Expression Region

1-669

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKR YFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQH GRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLK YWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVV TLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGE DDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFL GSTIQMGLSGSNFPAEDWLWNYEKHGNRHSVMRRVKRFLSTHEHPGSPRRRRSFGRQASD SSMFLPPSPARDLLDVPSRNPHRGSPTRKQSRSQEGSPKLHSSMGELSTIRETSRTSTLQ SLSPQSSVRSSPTKMPQVPEVLITAAEAPAFSADSHQHDSTTSILSLEFTGVQPSGTEQQ VEPSGTPPGDPNPQTTSASTERDLFKFEEDLEDDRFPKRWSLPEFLESRHTSLGNLGPDP VSPRDALLLPDTETPSETNGIHPGAGSALAPDILYLMESLDKETDILEFNNEHTGESPKG TPQRPRTWF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Aryl Hydrocarbon Receptor Nuclear Translocator-Like Protein 1 (ARNTL) ELISA Kit
MBS9398581 Inquire

Goose Aryl Hydrocarbon Receptor Nuclear Translocator-Like Protein 1 (ARNTL) ELISA Kit

Sign In for Pricing
View Details
CCDC60 (Coiled-coil Domain-Containing Protein 60, Coiled-coil Domain Containing 60)
477306 100 µL

CCDC60 (Coiled-coil Domain-Containing Protein 60, Coiled-coil Domain Containing 60)

Sign In for Pricing
View Details
Guluronic acid
T39051 50 mg

Guluronic acid

Sign In for Pricing
View Details
PE/Dazzle™ 594 anti-mouse CD16/32
GT05781 25 µg

PE/Dazzle™ 594 anti-mouse CD16/32

Sign In for Pricing
View Details
MASP1, ID (MASP1, CRARF, CRARF1, PRSS5, Mannan-binding lectin serine protease 1, Complement factor MASP-3, Complement-activating component of Ra-reactive factor, Mannose-binding lectin-associated serine protease 1, Mannose-binding protein-associated serine protease, Ra-reactive factor serine protease p100, Serine protease 5, Mannan-binding lectin serine protease 1 heavy chain, Mannan-binding lectin serine protease 1 light chain)
038213 200 µL

MASP1, ID (MASP1, CRARF, CRARF1, PRSS5, Mannan-binding lectin serine protease 1, Complement factor MASP-3, Complement-activating component of Ra-reactive factor, Mannose-binding lectin-associated serine protease 1, Mannose-binding protein-associated serine protease, Ra-reactive factor serine protease p100, Serine protease 5, Mannan-binding lectin serine protease 1 heavy chain, Mannan-binding lectin serine protease 1 light chain)

Sign In for Pricing
View Details
SOX5 Rabbit Polyclonal Antibody (HRP)
orb472515 100 µL

SOX5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details