Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD (ysxD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD (ysxD) spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ysxD, ORFY

UniProt

P40736

Expression Region

1-165

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Transducer And Activator Of Transcription 6 Phospho-Thr645 (STAT6 pT645) Antibody
abx332905 100 µL

Signal Transducer And Activator Of Transcription 6 Phospho-Thr645 (STAT6 pT645) Antibody

Sign In for Pricing
View Details
GAMT Human qPCR Primer Pair (NM_138924)
HP231157 200 Reactions

GAMT Human qPCR Primer Pair (NM_138924)

Sign In for Pricing
View Details
Recombinant Immunoglobulin M (IgM)
MBS2122646-01 0.01 mg

Recombinant Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Recombinant Immunoglobulin M (IgM)
MBS2122646-02 0.05 mg

Recombinant Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Recombinant Immunoglobulin M (IgM)
MBS2122646-03 0.1 mg

Recombinant Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Recombinant Immunoglobulin M (IgM)
MBS2122646-04 0.2 mg

Recombinant Immunoglobulin M (IgM)

Sign In for Pricing
View Details