Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827)
This Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827) spans the amino acid sequence from region 1-180.
Product Specifications
Product Name Alternative
UPF0059 membrane protein PTH_2827
UniProt
A5CYC0
Expression Region
1-180
Origin
Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSFFTLMALAVALGTDALSLSVGIGLTGISRRRILQISATVLLFHIFMPLTGWLVGEFTG SLIGRAAAVIGSLLLVGLGVKMIWAAWRNGGETEPSLVRFNFWGLLLLGASVSMDALSAG FTLGTRQVNLLLAAGVIGLVAGAMTAGGLVFGRFLGSRVGERAQLLGGLILVGIGIKLFF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470012-100 1x 100 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
