Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380)

This Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

Q68WY5

Expression Region

1-180

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYIIDKKVSKLSIISSTVL FVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWIIL SYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyBath™ 8L Digital Water Bath, 230V
B2000-8-E 1 Each

MyBath™ 8L Digital Water Bath, 230V

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS651264 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF594 conjugate, 0.1mg/mL
BNC942136-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BDH1 Human Gene Knockout Kit (CRISPR)
KN400873 1 Kit

BDH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rnf169 Mouse Gene Knockout Kit (CRISPR)
KN514922 1 Kit

Rnf169 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SHOX (NM_000451) Human Over-expression Lysate
LC424707 20 µg

SHOX (NM_000451) Human Over-expression Lysate

Sign In for Pricing
View Details