Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380)

This Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

Q68WY5

Expression Region

1-180

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYIIDKKVSKLSIISSTVL FVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWIIL SYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JWH-122 5-Hydroxypentyl (1.0mg/ml in Acetonitrile)
TRC-KIT5435-1X1ML 1 mL

JWH-122 5-Hydroxypentyl (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
Recombinant Acox1 Antibody
RC-4296-01 50 μL

Recombinant Acox1 Antibody

Sign In for Pricing
View Details
Recombinant Acox1 Antibody
RC-4296-02 100 µL

Recombinant Acox1 Antibody

Sign In for Pricing
View Details
Recombinant Acox1 Antibody
RC-4296-03 1 mL

Recombinant Acox1 Antibody

Sign In for Pricing
View Details
NP-I / NPTX1 Recombinant Rabbit monoclonal Antibody
HA751613 100 µL

NP-I / NPTX1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GPR149 (NM_001038705) Human Over-expression Lysate
LY422009 100 µg

GPR149 (NM_001038705) Human Over-expression Lysate

Sign In for Pricing
View Details