Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380)

This Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

Q68WY5

Expression Region

1-180

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYIIDKKVSKLSIISSTVL FVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWIIL SYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC191 Human Gene Knockout Kit (CRISPR)
KN421715 1 Kit

CCDC191 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rdh9 Mouse Gene Knockout Kit (CRISPR)
KN514634 1 Kit

Rdh9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Cbx2 activation kit by CRISPRa
GA200569 1 Kit

Mouse Cbx2 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Monkey EGFR (Epidermal Growth Factor Receptor) ELISA Kit
E-UNEL-MK0002-01 5x 96 Tests

Uncoated Monkey EGFR (Epidermal Growth Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Monkey EGFR (Epidermal Growth Factor Receptor) ELISA Kit
E-UNEL-MK0002-02 15x 96 Tests

Uncoated Monkey EGFR (Epidermal Growth Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
CF®770-Dextran 70,000 MW, Anionic and Fixable
#80123 1x 1 mg

CF®770-Dextran 70,000 MW, Anionic and Fixable

Sign In for Pricing
View Details