Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans UPF0059 membrane protein BH3770 (BH3770)

This Recombinant Bacillus halodurans UPF0059 membrane protein BH3770 (BH3770) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

UPF0059 membrane protein BH3770

UniProt

Q9K6F9

Expression Region

1-181

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVEELIALLIMASALGMDAFSIALGMGTLGLRFSQMFKVGLTIGVFHVIMPLMGMVAGKL LSAHLGLFANWLGAGLLLWLGLVMIVSPFQEKERTFVDPSGIGLFVFALSVSLDSLSAGL SLGMVGAKMALAVVAMGVMSTVLSWLGLFIGMRFQRYVGPYSELLGGFILCGFGVKLLLP Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (CLH5), CF568 conjugate, 0.1mg/mL
BNC680891-100 1x 100 µL

Mucin 6 (MUC6) (CLH5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF740 conjugate, 0.1mg/mL
BNC741234-100 1x 100 µL

Bcl-2 (100/D5 + 124), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL
BNC400796-100 1x 100 µL

Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details