Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0059 membrane protein BT9727_5008 (BT9727_5008)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0059 membrane protein BT9727_5008 (BT9727_5008) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

UPF0059 membrane protein BT9727_5008

UniProt

Q6HAV9

Expression Region

1-182

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR VLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTTPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppard siRNA Oligos set (Mouse)
37297174 3x 5 nmol

Ppard siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
NAF1 Human shRNA Lentiviral Particle (Locus ID 92345)
TL307474V 500 µL Each

NAF1 Human shRNA Lentiviral Particle (Locus ID 92345)

Sign In for Pricing
View Details
Human GATA-4 MAb (Clone 532020)
MAB2606 100 µg

Human GATA-4 MAb (Clone 532020)

Sign In for Pricing
View Details
EPS8L1 (NM_017729) Human Recombinant Protein
TP304919M 100 µg

EPS8L1 (NM_017729) Human Recombinant Protein

Sign In for Pricing
View Details
HNF-3α CRISPR/Cas9 KO Plasmid (h2)
sc-400743-KO-2 20 µg

HNF-3α CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details
WWC2-AS2 ORF Vector (Human) (pORF)
50483011 1.0 µg DNA

WWC2-AS2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details