Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis UPF0059 membrane protein OB2993 (OB2993)

This Recombinant Oceanobacillus iheyensis UPF0059 membrane protein OB2993 (OB2993) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

UPF0059 membrane protein OB2993

UniProt

Q8EM65

Expression Region

1-182

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFTSEIISIILLAIGLSMDGFSVSLGLGMQQLRLKRIAYIGLTIGFLHMLMPLAGMLLG QVISEQIGQWTSFAGGVLLFLIGAHMFFSAFRLTEGFRWQPVGVGLWIIAFSVSLDSFTV GLGLGISGVQIFVTLFAFGIVSCFLTWLGMLIGRKVYRFLGVYSELLGGSILCGFGIFIL FS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF405S conjugate, 0.1mg/mL
BNC040167-500 1x 500 µL

GFAP (GA-5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF405S conjugate, 0.1mg/mL
BNC042714-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF640R conjugate, 0.1mg/mL
BNC400917-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details