Recombinant Bacillus subtilis UPF0059 membrane protein ywlD (ywlD)
This Recombinant Bacillus subtilis UPF0059 membrane protein ywlD (ywlD) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
UPF0059 membrane protein ywlD
UniProt
P39154
Expression Region
1-185
Origin
Bacillus subtilis (strain 168)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSDLFIGELITLSIMAFALGMDAFSVGLGMGMVKLRKKQIFYIGFIIGLFHVIMPLAGMA AGNMLSGLLGVLAVYIGGALLFVLGVQMLMASFKQSEERFMSPAGPGLLLFAIGVSLDSF SVGLSLGIYGSHPLLTITLFGLFSMMLTWLGLLVGKQVQSWLGTYSEALGGIILIVFGLK LLLPI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041815-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941932-100 1x 100 µL
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881424-100 1x 100 µL
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details