Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 UPF0059 membrane protein Cj0167c (Cj0167c)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 UPF0059 membrane protein Cj0167c (Cj0167c) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

UPF0059 membrane protein Cj0167c

UniProt

Q9PIW1

Expression Region

1-187

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFYSLIFLSCALGMDAFAVSLCKGFSVKKLHLKHYLIVGIYFGGFQALMPTIGYFIGIT FASFIASIDHWIAFILLSLIGLKMIKESLENENCDSNANQFGFKTMLALAIATSIDALAV GVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNKAELLGGLVLIILGVKIL IEHLFFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Stambp ELISA Kit
ELI-53302r 96 Tests

Rat Stambp ELISA Kit

Sign In for Pricing
View Details
Try5 Protein Lysate (Mouse) with C-HA Tag
48541034 100 µg

Try5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
ALDH1A2 Rabbit Polyclonal Antibody (HRP)
orb2098223 100 µL

ALDH1A2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human CCL28 Protein
CRP1192-01 10 µg

Recombinant Human CCL28 Protein

Sign In for Pricing
View Details
Recombinant Human CCL28 Protein
CRP1192-02 50 µg

Recombinant Human CCL28 Protein

Sign In for Pricing
View Details
Recombinant Human CCL28 Protein
CRP1192-03 500 µg

Recombinant Human CCL28 Protein

Sign In for Pricing
View Details