Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yaaH (yaaH)

This Recombinant Inner membrane protein yaaH (yaaH) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Inner membrane protein yaaH

UniProt

P0AC99

Expression Region

1-188

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKK GNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKG ARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQFGRT VLPIGESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetylneuraminic Acid
TRC-A187000-1G 1 g

N-Acetylneuraminic Acid

Sign In for Pricing
View Details
RIN1 Rabbit Polyclonal Antibody
TA380929 100 µL

RIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF488A conjugate, 0.1mg/mL
BNC880499-100 1x 100 µL

Cytokeratin 14 (LL002), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GST Recombinant Rabbit monoclonal Antibody
HA720225F 100 µL

GST Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Buccutite™ FOL scavenger
5360-AAT 2 µmole

Buccutite™ FOL scavenger

Sign In for Pricing
View Details
Laminin Receptor / RPSA (Marker of Metastatic Potential) (RPSA/2699), CF640R conjugate, 0.1mg/mL
BNC402699-500 1x 500 µL

Laminin Receptor / RPSA (Marker of Metastatic Potential) (RPSA/2699), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details