Recombinant Enterobacter sp. UPF0059 membrane protein Ent638_2390 (Ent638_2390)
This Recombinant Enterobacter sp. UPF0059 membrane protein Ent638_2390 (Ent638_2390) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
UPF0059 membrane protein Ent638_2390
UniProt
A4WBH9
Expression Region
1-188
Origin
Enterobacter sp. (strain 638)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNISATILLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAIETLTPLIGWSLGML ASQFILEWNHWIAFTLLVFLGGRMVIEGFRNTPDEDDAPQYRHGFWILVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTIGMMVGRFIGPLLGKRAEILGGIVLIGIGGQ ILWSHFAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details