Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthobacter autotrophicus UPF0059 membrane protein Xaut_4096 (Xaut_4096)

This Recombinant Xanthobacter autotrophicus UPF0059 membrane protein Xaut_4096 (Xaut_4096) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

UPF0059 membrane protein Xaut_4096

UniProt

A7IMS5

Expression Region

1-188

Origin

Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPATILVLAMSMSVDAFAVSVGRGAALGRPRLSEALRTGAVFGAVEAATPLIGWAAGMV ASSYLEAIDHWIAFGLLAGVGLHMLVAAFSRRDEEADDTPRGRSIWVLLATALGTSIDAM AVGVSLAFLNVNIVVVALAIGAMSFLMSSGGMLVGRMVGQKFGRLAEVVAGVALCGLGLA ILIEHLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF740 conjugate, 0.1mg/mL
BNC740842-100 1x 100 µL

MUC2 (MLP/842), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details