Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882 (Clos_0882)

This Recombinant Alkaliphilus oremlandii UPF0059 membrane protein Clos_0882 (Clos_0882) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

UPF0059 membrane protein Clos_0882

UniProt

A8MEV0

Expression Region

1-188

Origin

Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs) )

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLIELTFIAVALSMDAFAAAICKGLCMKKNALKNTIIVGIFFGGFQAIMPLIGYILGTQ FNESISSIDHWIAFILLSIIGINMIRESREDDCSCDVDYSDSSFGMKNMTLLALATSIDA LAVGVTFAFLKVKIAPAIGIIGAITFILSIIGVKIGTVFGMKYKSKAEIAGGVILITMGA KILLEHLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF640R conjugate, 0.1mg/mL
BNC401858-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/1094), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (E29), CF640R conjugate, 0.1mg/mL
BNC400478-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (E29), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (Ks19.1), CF405S conjugate, 0.1mg/mL
BNC040394-500 1x 500 µL

Cytokeratin 19 (Ks19.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details