Recombinant Clostridium cellulolyticum UPF0059 membrane protein Ccel_1412 (Ccel_1412)
This Recombinant Clostridium cellulolyticum UPF0059 membrane protein Ccel_1412 (Ccel_1412) spans the amino acid sequence from region 1-189.
Product Specifications
Product Name Alternative
UPF0059 membrane protein Ccel_1412
UniProt
B8I1G8
Expression Region
1-189
Origin
Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLTELILLAIGLSMDASAVSISNSLCIKKIKIKHILQMAVMFAVFQGIMPLIGYYAANS FENVIERFDHWIAFILLVIIGGKMIHESITADEEQDCSLFSLTFKLLLVQAVATSIDALA VGVSLSALNVDILYSITIIGIVTFICCTAAILLANRFGNLLGKRAGIVGGLILVGIGVKI FVQHMFFGG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471081-100 1x 100 µL
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402747-100 1x 100 µL
TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682302-500 1x 500 µL
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details