Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein hdeD (hdeD)

This Recombinant Protein hdeD (hdeD) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Protein hdeD

UniProt

P0AET6

Expression Region

1-190

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYIDKATILKFDLEMLKKHRRAIQFIAVLLFIVGLLCISFPFVSGDILSTVVGALLICS GIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGV IRLMSWYRQRSMKGSWLQLVIGVLDIVIAWIFLGATPMVSVTLVSTLVGIELIFSAASLF SFASLFVKQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CCL20 (CCL20) ELISA Kit
YP-W22207-01 48 Tests

Mouse CCL20 (CCL20) ELISA Kit

Sign In for Pricing
View Details
Mouse CCL20 (CCL20) ELISA Kit
YP-W22207-02 96 Tests

Mouse CCL20 (CCL20) ELISA Kit

Sign In for Pricing
View Details
SLC4A4 Antibody
MBS8502153-01 0.1 mg

SLC4A4 Antibody

Sign In for Pricing
View Details
SLC4A4 Antibody
MBS8502153-02 0.1 mL (AF405L)

SLC4A4 Antibody

Sign In for Pricing
View Details
SLC4A4 Antibody
MBS8502153-03 0.1 mL (AF405S)

SLC4A4 Antibody

Sign In for Pricing
View Details
SLC4A4 Antibody
MBS8502153-04 0.1 mL (AF610)

SLC4A4 Antibody

Sign In for Pricing
View Details