Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein hdeD (hdeD)

This Recombinant Protein hdeD (hdeD) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Protein hdeD

UniProt

P0AET6

Expression Region

1-190

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYIDKATILKFDLEMLKKHRRAIQFIAVLLFIVGLLCISFPFVSGDILSTVVGALLICS GIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGV IRLMSWYRQRSMKGSWLQLVIGVLDIVIAWIFLGATPMVSVTLVSTLVGIELIFSAASLF SFASLFVKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caldesmon Rabbit Polyclonal Antibody (Cy7)
orb1051379 100 µL

Caldesmon Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
XRCC4 Rabbit Polyclonal Antibody
orb2008-01 50 μL

XRCC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XRCC4 Rabbit Polyclonal Antibody
orb2008-02 100 µL

XRCC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XRCC4 Rabbit Polyclonal Antibody
orb2008-03 200 µL

XRCC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Oxycodone Antibody (A12)
YP268013-01 50 µg

Anti-Oxycodone Antibody (A12)

Sign In for Pricing
View Details
Anti-Oxycodone Antibody (A12)
YP268013-02 100 µg

Anti-Oxycodone Antibody (A12)

Sign In for Pricing
View Details